Anti CAMKK2 pAb (ATL-HPA017389)

Atlas Antibodies

Catalog No.:
ATL-HPA017389-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calcium/calmodulin-dependent protein kinase kinase 2, beta
Gene Name: CAMKK2
Alternative Gene Name: CAMKK, CAMKKB, KIAA0787, MGC15254
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029471: 77%, ENSRNOG00000001309: 81%
Entrez Gene ID: 10645
Uniprot ID: Q96RR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
Gene Sequence SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS
Gene ID - Mouse ENSMUSG00000029471
Gene ID - Rat ENSRNOG00000001309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMKK2 pAb (ATL-HPA017389)
Datasheet Anti CAMKK2 pAb (ATL-HPA017389) Datasheet (External Link)
Vendor Page Anti CAMKK2 pAb (ATL-HPA017389) at Atlas Antibodies

Documents & Links for Anti CAMKK2 pAb (ATL-HPA017389)
Datasheet Anti CAMKK2 pAb (ATL-HPA017389) Datasheet (External Link)
Vendor Page Anti CAMKK2 pAb (ATL-HPA017389)
Citations for Anti CAMKK2 pAb (ATL-HPA017389) – 12 Found
Nanba, Kazutaka; Chen, Andrew; Nishimoto, Koshiro; Rainey, William E. Role of Ca(2+)/calmodulin-dependent protein kinase kinase in adrenal aldosterone production. Endocrinology. 2015;156(5):1750-6.  PubMed
Barfeld, Stefan J; Urbanucci, Alfonso; Itkonen, Harri M; Fazli, Ladan; Hicks, Jessica L; Thiede, Bernd; Rennie, Paul S; Yegnasubramanian, Srinivasan; DeMarzo, Angelo M; Mills, Ian G. c-Myc Antagonises the Transcriptional Activity of the Androgen Receptor in Prostate Cancer Affecting Key Gene Networks. Ebiomedicine. 2017;18( 28412251):83-93.  PubMed
Kuenzi, Brent M; Remsing Rix, Lily L; Stewart, Paul A; Fang, Bin; Kinose, Fumi; Bryant, Annamarie T; Boyle, Theresa A; Koomen, John M; Haura, Eric B; Rix, Uwe. Polypharmacology-based ceritinib repurposing using integrated functional proteomics. Nature Chemical Biology. 2017;13(12):1222-1231.  PubMed
Sabbir, Mohammad Golam. Loss of Ca(2+)/Calmodulin Dependent Protein Kinase Kinase 2 Leads to Aberrant Transferrin Phosphorylation and Trafficking: A Potential Biomarker for Alzheimer's Disease. Frontiers In Molecular Biosciences. 5( 30525042):99.  PubMed
Racioppi, Luigi; Nelson, Erik R; Huang, Wei; Mukherjee, Debarati; Lawrence, Scott A; Lento, William; Masci, Anna Maria; Jiao, Yiquin; Park, Sunghee; York, Brian; Liu, Yaping; Baek, Amy E; Drewry, David H; Zuercher, William J; Bertani, Francesca R; Businaro, Luca; Geradts, Joseph; Hall, Allison; Means, Anthony R; Chao, Nelson; Chang, Ching-Yi; McDonnell, Donald P. CaMKK2 in myeloid cells is a key regulator of the immune-suppressive microenvironment in breast cancer. Nature Communications. 2019;10(1):2450.  PubMed
Kratimenos, Panagiotis; Vij, Abhya; Vidva, Robinson; Koutroulis, Ioannis; Delivoria-Papadopoulos, Maria; Gallo, Vittorio; Sathyanesan, Aaron. Computational analysis of cortical neuronal excitotoxicity in a large animal model of neonatal brain injury. Journal Of Neurodevelopmental Disorders. 2022;14(1):26.  PubMed
Massie, Charles E; Lynch, Andy; Ramos-Montoya, Antonio; Boren, Joan; Stark, Rory; Fazli, Ladan; Warren, Anne; Scott, Helen; Madhu, Basetti; Sharma, Naomi; Bon, Helene; Zecchini, Vinny; Smith, Donna-Michelle; Denicola, Gina M; Mathews, Nik; Osborne, Michelle; Hadfield, James; Macarthur, Stewart; Adryan, Boris; Lyons, Scott K; Brindle, Kevin M; Griffiths, John; Gleave, Martin E; Rennie, Paul S; Neal, David E; Mills, Ian G. The androgen receptor fuels prostate cancer by regulating central metabolism and biosynthesis. The Embo Journal. 2011;30(13):2719-33.  PubMed
Subbannayya, Yashwanth; Syed, Nazia; Barbhuiya, Mustafa A; Raja, Remya; Marimuthu, Arivusudar; Sahasrabuddhe, Nandini; Pinto, Sneha M; Manda, Srikanth Srinivas; Renuse, Santosh; Manju, H C; Zameer, Mohammed Abdul Lateef; Sharma, Jyoti; Brait, Mariana; Srikumar, Kotteazeth; Roa, Juan Carlos; Vijaya Kumar, M; Kumar, K V Veerendra; Prasad, T S Keshava; Ramaswamy, Girija; Kumar, Rekha Vijay; Pandey, Akhilesh; Gowda, Harsha; Chatterjee, Aditi. Calcium calmodulin dependent kinase kinase 2 - a novel therapeutic target for gastric adenocarcinoma. Cancer Biology & Therapy. 16(2):336-45.  PubMed
Ctortecka, Claudia; Palve, Vinayak; Kuenzi, Brent M; Fang, Bin; Sumi, Natalia J; Izumi, Victoria; Novakova, Silvia; Kinose, Fumi; Remsing Rix, Lily L; Haura, Eric B; Koomen, John Matthew; Rix, Uwe. Functional Proteomics and Deep Network Interrogation Reveal a Complex Mechanism of Action of Midostaurin in Lung Cancer Cells. Molecular & Cellular Proteomics : Mcp. 2018;17(12):2434-2447.  PubMed
Hedman, Andrew C; Li, Zhigang; Gorisse, Laëtitia; Parvathaneni, Swetha; Morgan, Chase J; Sacks, David B. IQGAP1 binds AMPK and is required for maximum AMPK activation. The Journal Of Biological Chemistry. 2021;296( 33191271):100075.  PubMed
Mao, Jia-Yu; Su, Long-Xiang; Li, Dong-Kai; Zhang, Hong-Min; Wang, Xiao-Ting; Liu, Da-Wei. The effects of UCP2 on autophagy through the AMPK signaling pathway in septic cardiomyopathy and the underlying mechanism. Annals Of Translational Medicine. 2021;9(3):259.  PubMed
Stewart, Lorna M; Gerner, Lisa; Rettel, Mandy; Stein, Frank; Burrows, James F; Mills, Ian G; Evergren, Emma. CaMKK2 facilitates Golgi-associated vesicle trafficking to sustain cancer cell proliferation. Cell Death & Disease. 2021;12(11):1040.  PubMed