Anti CAMKK1 pAb (ATL-HPA028062 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA028062-100

• 
• 

Protein Description: calcium/calmodulin-dependent protein kinase kinase 1, alpha
Gene Name: CAMKK1
Alternative Gene Name: CAMKKA, DKFZp761M0423, MGC34095
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020785: 93%, ENSRNOG00000018242: 96%
Entrez Gene ID: 84254
Uniprot ID: Q8N5S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS
• Gene Sequence: KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS
• Gene ID - Mouse: ENSMUSG00000020785
• Gene ID - Rat: ENSRNOG00000018242
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.