Anti CAMK4 pAb (ATL-HPA017206)

Atlas Antibodies

SKU: ATL-HPA017206-25

• 
• 

Protein Description: calcium/calmodulin-dependent protein kinase IV
Gene Name: CAMK4
Alternative Gene Name: CaMK-GR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038128: 99%, ENSRNOG00000020478: 99%
Entrez Gene ID: 814
Uniprot ID: Q16566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
• Gene Sequence: GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
• Gene ID - Mouse: ENSMUSG00000038128
• Gene ID - Rat: ENSRNOG00000020478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CAMK4 pAb (ATL-HPA017206) – 2 Found

Harrison, Benjamin J; Flight, Robert M; Gomes, Cynthia; Venkat, Gayathri; Ellis, Steven R; Sankar, Uma; Twiss, Jeffery L; Rouchka, Eric C; Petruska, Jeffrey C. IB4-binding sensory neurons in the adult rat express a novel 3' UTR-extended isoform of CaMK4 that is associated with its localization to axons. The Journal Of Comparative Neurology. 2014;522(2):308-36. 

Duda, Przemysław; Wójtowicz, Tomasz; Janczara, Jakub; Krowarsch, Daniel; Czyrek, Aleksandra; Gizak, Agnieszka; Rakus, Dariusz. Fructose 1,6-Bisphosphatase 2 Plays a Crucial Role in the Induction and Maintenance of Long-Term Potentiation. Cells. 2020;9(6)