Anti CAMK4 pAb (ATL-HPA017206)

Atlas Antibodies

Catalog No.:
ATL-HPA017206-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: calcium/calmodulin-dependent protein kinase IV
Gene Name: CAMK4
Alternative Gene Name: CaMK-GR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038128: 99%, ENSRNOG00000020478: 99%
Entrez Gene ID: 814
Uniprot ID: Q16566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
Gene Sequence GIITYILLCGFEPFYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWVTGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSS
Gene ID - Mouse ENSMUSG00000038128
Gene ID - Rat ENSRNOG00000020478
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMK4 pAb (ATL-HPA017206)
Datasheet Anti CAMK4 pAb (ATL-HPA017206) Datasheet (External Link)
Vendor Page Anti CAMK4 pAb (ATL-HPA017206) at Atlas Antibodies

Documents & Links for Anti CAMK4 pAb (ATL-HPA017206)
Datasheet Anti CAMK4 pAb (ATL-HPA017206) Datasheet (External Link)
Vendor Page Anti CAMK4 pAb (ATL-HPA017206)
Citations for Anti CAMK4 pAb (ATL-HPA017206) – 2 Found
Harrison, Benjamin J; Flight, Robert M; Gomes, Cynthia; Venkat, Gayathri; Ellis, Steven R; Sankar, Uma; Twiss, Jeffery L; Rouchka, Eric C; Petruska, Jeffrey C. IB4-binding sensory neurons in the adult rat express a novel 3' UTR-extended isoform of CaMK4 that is associated with its localization to axons. The Journal Of Comparative Neurology. 2014;522(2):308-36.  PubMed
Duda, Przemysław; Wójtowicz, Tomasz; Janczara, Jakub; Krowarsch, Daniel; Czyrek, Aleksandra; Gizak, Agnieszka; Rakus, Dariusz. Fructose 1,6-Bisphosphatase 2 Plays a Crucial Role in the Induction and Maintenance of Long-Term Potentiation. Cells. 2020;9(6)  PubMed