Anti CAMK4 pAb (ATL-HPA011753)

Atlas Antibodies

SKU: ATL-HPA011753-100

• 
• 
• 

Protein Description: calcium/calmodulin-dependent protein kinase IV
Gene Name: CAMK4
Alternative Gene Name: CaMK-GR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038128: 32%, ENSRNOG00000020478: 34%
Entrez Gene ID: 814
Uniprot ID: Q16566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ
• Gene Sequence: GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ
• Gene ID - Mouse: ENSMUSG00000038128
• Gene ID - Rat: ENSRNOG00000020478
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CAMK4 pAb (ATL-HPA011753) – 2 Found

Harrison, Benjamin J; Flight, Robert M; Gomes, Cynthia; Venkat, Gayathri; Ellis, Steven R; Sankar, Uma; Twiss, Jeffery L; Rouchka, Eric C; Petruska, Jeffrey C. IB4-binding sensory neurons in the adult rat express a novel 3' UTR-extended isoform of CaMK4 that is associated with its localization to axons. The Journal Of Comparative Neurology. 2014;522(2):308-36. 

Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24.