Anti CAMK4 pAb (ATL-HPA011753)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011753-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: CAMK4
Alternative Gene Name: CaMK-GR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038128: 32%, ENSRNOG00000020478: 34%
Entrez Gene ID: 814
Uniprot ID: Q16566
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ |
Gene Sequence | GNEDMKAIPEGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQ |
Gene ID - Mouse | ENSMUSG00000038128 |
Gene ID - Rat | ENSRNOG00000020478 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAMK4 pAb (ATL-HPA011753) | |
Datasheet | Anti CAMK4 pAb (ATL-HPA011753) Datasheet (External Link) |
Vendor Page | Anti CAMK4 pAb (ATL-HPA011753) at Atlas Antibodies |
Documents & Links for Anti CAMK4 pAb (ATL-HPA011753) | |
Datasheet | Anti CAMK4 pAb (ATL-HPA011753) Datasheet (External Link) |
Vendor Page | Anti CAMK4 pAb (ATL-HPA011753) |
Citations for Anti CAMK4 pAb (ATL-HPA011753) – 2 Found |
Harrison, Benjamin J; Flight, Robert M; Gomes, Cynthia; Venkat, Gayathri; Ellis, Steven R; Sankar, Uma; Twiss, Jeffery L; Rouchka, Eric C; Petruska, Jeffrey C. IB4-binding sensory neurons in the adult rat express a novel 3' UTR-extended isoform of CaMK4 that is associated with its localization to axons. The Journal Of Comparative Neurology. 2014;522(2):308-36. PubMed |
Edfors, Fredrik; Boström, Tove; Forsström, Björn; Zeiler, Marlis; Johansson, Henrik; Lundberg, Emma; Hober, Sophia; Lehtiö, Janne; Mann, Matthias; Uhlen, Mathias. Immunoproteomics using polyclonal antibodies and stable isotope-labeled affinity-purified recombinant proteins. Molecular & Cellular Proteomics : Mcp. 2014;13(6):1611-24. PubMed |