Anti CAMK2N2 pAb (ATL-HPA075200)
Atlas Antibodies
- SKU:
- ATL-HPA075200-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CAMK2N2
Alternative Gene Name: CaM-KIIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051146: 100%, ENSRNOG00000038184: 100%
Entrez Gene ID: 94032
Uniprot ID: Q96S95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKRPPKLGQIGRAKRVVIEDDRIDDVLKGM |
Gene Sequence | AKRPPKLGQIGRAKRVVIEDDRIDDVLKGM |
Gene ID - Mouse | ENSMUSG00000051146 |
Gene ID - Rat | ENSRNOG00000038184 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAMK2N2 pAb (ATL-HPA075200) | |
Datasheet | Anti CAMK2N2 pAb (ATL-HPA075200) Datasheet (External Link) |
Vendor Page | Anti CAMK2N2 pAb (ATL-HPA075200) at Atlas Antibodies |
Documents & Links for Anti CAMK2N2 pAb (ATL-HPA075200) | |
Datasheet | Anti CAMK2N2 pAb (ATL-HPA075200) Datasheet (External Link) |
Vendor Page | Anti CAMK2N2 pAb (ATL-HPA075200) |