Anti CAMK2N2 pAb (ATL-HPA075200)

Atlas Antibodies

SKU: ATL-HPA075200-25

• 

Protein Description: calcium/calmodulin dependent protein kinase II inhibitor 2
Gene Name: CAMK2N2
Alternative Gene Name: CaM-KIIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051146: 100%, ENSRNOG00000038184: 100%
Entrez Gene ID: 94032
Uniprot ID: Q96S95
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKRPPKLGQIGRAKRVVIEDDRIDDVLKGM
• Gene Sequence: AKRPPKLGQIGRAKRVVIEDDRIDDVLKGM
• Gene ID - Mouse: ENSMUSG00000051146
• Gene ID - Rat: ENSRNOG00000038184
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.