Anti CAMK2G pAb (ATL-HPA040656)

Atlas Antibodies

Catalog No.:
ATL-HPA040656-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: calcium/calmodulin-dependent protein kinase II gamma
Gene Name: CAMK2G
Alternative Gene Name: CAMKG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021820: 72%, ENSRNOG00000009783: 97%
Entrez Gene ID: 818
Uniprot ID: Q13555
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
Gene Sequence NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
Gene ID - Mouse ENSMUSG00000021820
Gene ID - Rat ENSRNOG00000009783
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMK2G pAb (ATL-HPA040656)
Datasheet Anti CAMK2G pAb (ATL-HPA040656) Datasheet (External Link)
Vendor Page Anti CAMK2G pAb (ATL-HPA040656) at Atlas Antibodies

Documents & Links for Anti CAMK2G pAb (ATL-HPA040656)
Datasheet Anti CAMK2G pAb (ATL-HPA040656) Datasheet (External Link)
Vendor Page Anti CAMK2G pAb (ATL-HPA040656)
Citations for Anti CAMK2G pAb (ATL-HPA040656) – 1 Found
Rigter, Pomme M F; de Konink, Charlotte; van Woerden, Geeske M. Loss of CAMK2G affects intrinsic and motor behavior but has minimal impact on cognitive behavior. Frontiers In Neuroscience. 16( 36685241):1086994.  PubMed