Anti CAMK2G pAb (ATL-HPA040656)

Atlas Antibodies

Catalog No.: ATL-HPA040656-25

Protein Description: calcium/calmodulin-dependent protein kinase II gamma
Gene Name: CAMK2G
Alternative Gene Name: CAMKG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021820: 72%, ENSRNOG00000009783: 97%
Entrez Gene ID: 818
Uniprot ID: Q13555
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
• Gene Sequence: NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR
• Gene ID - Mouse: ENSMUSG00000021820
• Gene ID - Rat: ENSRNOG00000009783
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CAMK2G pAb (ATL-HPA040656) – 1 Found

Rigter, Pomme M F; de Konink, Charlotte; van Woerden, Geeske M. Loss of CAMK2G affects intrinsic and motor behavior but has minimal impact on cognitive behavior. Frontiers In Neuroscience. 16( 36685241):1086994.