Anti CAMK2G pAb (ATL-HPA040656)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040656-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CAMK2G
Alternative Gene Name: CAMKG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021820: 72%, ENSRNOG00000009783: 97%
Entrez Gene ID: 818
Uniprot ID: Q13555
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR |
Gene Sequence | NSLVSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRTGNGSSVPEGRSSR |
Gene ID - Mouse | ENSMUSG00000021820 |
Gene ID - Rat | ENSRNOG00000009783 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAMK2G pAb (ATL-HPA040656) | |
Datasheet | Anti CAMK2G pAb (ATL-HPA040656) Datasheet (External Link) |
Vendor Page | Anti CAMK2G pAb (ATL-HPA040656) at Atlas Antibodies |
Documents & Links for Anti CAMK2G pAb (ATL-HPA040656) | |
Datasheet | Anti CAMK2G pAb (ATL-HPA040656) Datasheet (External Link) |
Vendor Page | Anti CAMK2G pAb (ATL-HPA040656) |
Citations for Anti CAMK2G pAb (ATL-HPA040656) – 1 Found |
Rigter, Pomme M F; de Konink, Charlotte; van Woerden, Geeske M. Loss of CAMK2G affects intrinsic and motor behavior but has minimal impact on cognitive behavior. Frontiers In Neuroscience. 16( 36685241):1086994. PubMed |