Anti CAMK2D pAb (ATL-HPA026281)

Atlas Antibodies

Catalog No.:
ATL-HPA026281-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calcium/calmodulin-dependent protein kinase II delta
Gene Name: CAMK2D
Alternative Gene Name: CAMKD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053819: 100%, ENSRNOG00000011589: 97%
Entrez Gene ID: 817
Uniprot ID: Q13557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
Gene Sequence MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
Gene ID - Mouse ENSMUSG00000053819
Gene ID - Rat ENSRNOG00000011589
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CAMK2D pAb (ATL-HPA026281)
Datasheet Anti CAMK2D pAb (ATL-HPA026281) Datasheet (External Link)
Vendor Page Anti CAMK2D pAb (ATL-HPA026281) at Atlas Antibodies

Documents & Links for Anti CAMK2D pAb (ATL-HPA026281)
Datasheet Anti CAMK2D pAb (ATL-HPA026281) Datasheet (External Link)
Vendor Page Anti CAMK2D pAb (ATL-HPA026281)