Anti CAMK2D pAb (ATL-HPA026281)
Atlas Antibodies
- SKU:
- ATL-HPA026281-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CAMK2D
Alternative Gene Name: CAMKD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053819: 100%, ENSRNOG00000011589: 97%
Entrez Gene ID: 817
Uniprot ID: Q13557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ |
Gene Sequence | MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ |
Gene ID - Mouse | ENSMUSG00000053819 |
Gene ID - Rat | ENSRNOG00000011589 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CAMK2D pAb (ATL-HPA026281) | |
Datasheet | Anti CAMK2D pAb (ATL-HPA026281) Datasheet (External Link) |
Vendor Page | Anti CAMK2D pAb (ATL-HPA026281) at Atlas Antibodies |
Documents & Links for Anti CAMK2D pAb (ATL-HPA026281) | |
Datasheet | Anti CAMK2D pAb (ATL-HPA026281) Datasheet (External Link) |
Vendor Page | Anti CAMK2D pAb (ATL-HPA026281) |