Anti CAMK2D pAb (ATL-HPA026281)

Atlas Antibodies

Catalog No.: ATL-HPA026281-25

Protein Description: calcium/calmodulin-dependent protein kinase II delta
Gene Name: CAMK2D
Alternative Gene Name: CAMKD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053819: 100%, ENSRNOG00000011589: 97%
Entrez Gene ID: 817
Uniprot ID: Q13557
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
• Gene Sequence: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ
• Gene ID - Mouse: ENSMUSG00000053819
• Gene ID - Rat: ENSRNOG00000011589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.