Anti CAMK2B pAb (ATL-HPA026307 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026307-25

• 
• 

Protein Description: calcium/calmodulin-dependent protein kinase II beta
Gene Name: CAMK2B
Alternative Gene Name: CAM2, CAMK2, CAMKB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057897: 96%, ENSRNOG00000052080: 96%
Entrez Gene ID: 816
Uniprot ID: Q13554
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
• Gene Sequence: TRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAATSPKGTLPPAALEPQTTVIH
• Gene ID - Mouse: ENSMUSG00000057897
• Gene ID - Rat: ENSRNOG00000052080
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.