Anti CAMK1D pAb (ATL-HPA007266 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA007266-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using HPA007266 antibody. Corresponding CAMK1D RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CAMK1D over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407015).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcium/calmodulin-dependent protein kinase ID
Gene Name: CAMK1D
Alternative Gene Name: CKLiK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039145: 100%, ENSRNOG00000017882: 98%
Entrez Gene ID: 57118
Uniprot ID: Q8IU85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG
Gene Sequence MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEIAVLRKIKHENIVALEDIYESPNHLYLVMQLVSGG
Gene ID - Mouse ENSMUSG00000039145
Gene ID - Rat ENSRNOG00000017882
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CAMK1D pAb (ATL-HPA007266 w/enhanced validation)
Datasheet Anti CAMK1D pAb (ATL-HPA007266 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CAMK1D pAb (ATL-HPA007266 w/enhanced validation)