Anti CALN1 pAb (ATL-HPA036278)

Atlas Antibodies

Catalog No.:
ATL-HPA036278-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calneuron 1
Gene Name: CALN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060371: 98%, ENSRNOG00000000886: 98%
Entrez Gene ID: 83698
Uniprot ID: Q9BXU9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAFRDHLTMKDIE
Gene Sequence FDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRITLEELKHILYHAFRDHLTMKDIE
Gene ID - Mouse ENSMUSG00000060371
Gene ID - Rat ENSRNOG00000000886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CALN1 pAb (ATL-HPA036278)
Datasheet Anti CALN1 pAb (ATL-HPA036278) Datasheet (External Link)
Vendor Page Anti CALN1 pAb (ATL-HPA036278) at Atlas Antibodies

Documents & Links for Anti CALN1 pAb (ATL-HPA036278)
Datasheet Anti CALN1 pAb (ATL-HPA036278) Datasheet (External Link)
Vendor Page Anti CALN1 pAb (ATL-HPA036278)