Anti CALML5 pAb (ATL-HPA040725 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040725-25
  • Immunohistochemistry analysis in human skin and skeletal muscle tissues using Anti-CALML5 antibody. Corresponding CALML5 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calmodulin-like 5
Gene Name: CALML5
Alternative Gene Name: CLSP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001175: 50%, ENSRNOG00000028576: 51%
Entrez Gene ID: 51806
Uniprot ID: Q9NZT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTA
Gene Sequence GELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDGDGDGEISFQEFLTA
Gene ID - Mouse ENSMUSG00000001175
Gene ID - Rat ENSRNOG00000028576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CALML5 pAb (ATL-HPA040725 w/enhanced validation)
Datasheet Anti CALML5 pAb (ATL-HPA040725 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALML5 pAb (ATL-HPA040725 w/enhanced validation)