Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017330-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CALD1
Alternative Gene Name: CDM, H-CAD, L-CAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 94%, ENSRNOG00000010233: 93%
Entrez Gene ID: 800
Uniprot ID: Q05682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD |
Gene Sequence | MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD |
Gene ID - Mouse | ENSMUSG00000029761 |
Gene ID - Rat | ENSRNOG00000010233 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) | |
Datasheet | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) | |
Datasheet | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) |
Citations for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) – 3 Found |
Köhler, Christoph N. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2011;59(5):504-17. PubMed |
Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54. PubMed |
Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. PubMed |