Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA017330-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: caldesmon 1
Gene Name: CALD1
Alternative Gene Name: CDM, H-CAD, L-CAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 94%, ENSRNOG00000010233: 93%
Entrez Gene ID: 800
Uniprot ID: Q05682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD
Gene Sequence MTHKLKHTENTFSRPGGRASVDTKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKLREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSDD
Gene ID - Mouse ENSMUSG00000029761
Gene ID - Rat ENSRNOG00000010233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation)
Datasheet Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation)
Datasheet Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation)
Citations for Anti CALD1 pAb (ATL-HPA017330 w/enhanced validation) – 3 Found
Köhler, Christoph N. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2011;59(5):504-17.  PubMed
Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54.  PubMed
Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84.  PubMed