Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008066-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CALD1
Alternative Gene Name: CDM, H-CAD, L-CAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 91%, ENSRNOG00000010233: 93%
Entrez Gene ID: 800
Uniprot ID: Q05682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS |
| Gene Sequence | SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS |
| Gene ID - Mouse | ENSMUSG00000029761 |
| Gene ID - Rat | ENSRNOG00000010233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) | |
| Datasheet | Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) | |
| Datasheet | Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) |
| Citations for Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) – 4 Found |
| Köhler, Christoph N. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2011;59(5):504-17. PubMed |
| Fagerberg, Linn; Stadler, Charlotte; Skogs, Marie; Hjelmare, Martin; Jonasson, Kalle; Wiking, Mikaela; Abergh, Annica; Uhlén, Mathias; Lundberg, Emma. Mapping the subcellular protein distribution in three human cell lines. Journal Of Proteome Research. 2011;10(8):3766-77. PubMed |
| Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. PubMed |
| Jackstadt, Rene; van Hooff, Sander R; Leach, Joshua D; Cortes-Lavaud, Xabier; Lohuis, Jeroen O; Ridgway, Rachel A; Wouters, Valérie M; Roper, Jatin; Kendall, Timothy J; Roxburgh, Campbell S; Horgan, Paul G; Nixon, Colin; Nourse, Craig; Gunzer, Matthias; Clark, William; Hedley, Ann; Yilmaz, Omer H; Rashid, Mamunur; Bailey, Peter; Biankin, Andrew V; Campbell, Andrew D; Adams, David J; Barry, Simon T; Steele, Colin W; Medema, Jan Paul; Sansom, Owen J. Epithelial NOTCH Signaling Rewires the Tumor Microenvironment of Colorectal Cancer to Drive Poor-Prognosis Subtypes and Metastasis. Cancer Cell. 2019;36(3):319-336.e7. PubMed |