Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008066-25

• 
• 
• 

Protein Description: caldesmon 1
Gene Name: CALD1
Alternative Gene Name: CDM, H-CAD, L-CAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029761: 91%, ENSRNOG00000010233: 93%
Entrez Gene ID: 800
Uniprot ID: Q05682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS
• Gene Sequence: SLKIEERAEFLNKSVQKSSGVKSTHQAAIVSKIDSRLEQYTSAIEGTKSAKPTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTS
• Gene ID - Mouse: ENSMUSG00000029761
• Gene ID - Rat: ENSRNOG00000010233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALD1 pAb (ATL-HPA008066 w/enhanced validation) – 4 Found

Köhler, Christoph N. Histochemical localization of caldesmon in the CNS and ganglia of the mouse. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2011;59(5):504-17. 

Fagerberg, Linn; Stadler, Charlotte; Skogs, Marie; Hjelmare, Martin; Jonasson, Kalle; Wiking, Mikaela; Abergh, Annica; Uhlén, Mathias; Lundberg, Emma. Mapping the subcellular protein distribution in three human cell lines. Journal Of Proteome Research. 2011;10(8):3766-77. 

Stadler, Charlotte; Hjelmare, Martin; Neumann, Beate; Jonasson, Kalle; Pepperkok, Rainer; Uhlén, Mathias; Lundberg, Emma. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. Journal Of Proteomics. 2012;75(7):2236-51. 

Jackstadt, Rene; van Hooff, Sander R; Leach, Joshua D; Cortes-Lavaud, Xabier; Lohuis, Jeroen O; Ridgway, Rachel A; Wouters, Valérie M; Roper, Jatin; Kendall, Timothy J; Roxburgh, Campbell S; Horgan, Paul G; Nixon, Colin; Nourse, Craig; Gunzer, Matthias; Clark, William; Hedley, Ann; Yilmaz, Omer H; Rashid, Mamunur; Bailey, Peter; Biankin, Andrew V; Campbell, Andrew D; Adams, David J; Barry, Simon T; Steele, Colin W; Medema, Jan Paul; Sansom, Owen J. Epithelial NOTCH Signaling Rewires the Tumor Microenvironment of Colorectal Cancer to Drive Poor-Prognosis Subtypes and Metastasis. Cancer Cell. 2019;36(3):319-336.e7.