Anti CALCRL pAb (ATL-HPA046515)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046515-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CALCRL
Alternative Gene Name: CGRPR, CRLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059588: 86%, ENSRNOG00000054695: 86%
Entrez Gene ID: 10203
Uniprot ID: Q16602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL |
| Gene Sequence | RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL |
| Gene ID - Mouse | ENSMUSG00000059588 |
| Gene ID - Rat | ENSRNOG00000054695 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CALCRL pAb (ATL-HPA046515) | |
| Datasheet | Anti CALCRL pAb (ATL-HPA046515) Datasheet (External Link) |
| Vendor Page | Anti CALCRL pAb (ATL-HPA046515) at Atlas Antibodies |
| Documents & Links for Anti CALCRL pAb (ATL-HPA046515) | |
| Datasheet | Anti CALCRL pAb (ATL-HPA046515) Datasheet (External Link) |
| Vendor Page | Anti CALCRL pAb (ATL-HPA046515) |