Anti CALCRL pAb (ATL-HPA046515)

Atlas Antibodies

Catalog No.:
ATL-HPA046515-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calcitonin receptor-like
Gene Name: CALCRL
Alternative Gene Name: CGRPR, CRLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059588: 86%, ENSRNOG00000054695: 86%
Entrez Gene ID: 10203
Uniprot ID: Q16602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL
Gene Sequence RNWNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEHLNGKSIHDIENVL
Gene ID - Mouse ENSMUSG00000059588
Gene ID - Rat ENSRNOG00000054695
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CALCRL pAb (ATL-HPA046515)
Datasheet Anti CALCRL pAb (ATL-HPA046515) Datasheet (External Link)
Vendor Page Anti CALCRL pAb (ATL-HPA046515) at Atlas Antibodies

Documents & Links for Anti CALCRL pAb (ATL-HPA046515)
Datasheet Anti CALCRL pAb (ATL-HPA046515) Datasheet (External Link)
Vendor Page Anti CALCRL pAb (ATL-HPA046515)