Anti CALCRL pAb (ATL-HPA008070)

Atlas Antibodies

SKU: ATL-HPA008070-25

• 

Protein Description: calcitonin receptor-like
Gene Name: CALCRL
Alternative Gene Name: CGRPR, CRLR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059588: 89%, ENSRNOG00000054695: 89%
Entrez Gene ID: 10203
Uniprot ID: Q16602
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA
• Gene Sequence: EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA
• Gene ID - Mouse: ENSMUSG00000059588
• Gene ID - Rat: ENSRNOG00000054695
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALCRL pAb (ATL-HPA008070) – 1 Found

Chou, Tse-Ming; Lee, Zhung-Fu; Wang, Shuu-Jiun; Lien, Cheng-Chang; Chen, Shih-Pin. CGRP-dependent sensitization of PKC-δ positive neurons in central amygdala mediates chronic migraine. The Journal Of Headache And Pain. 2022;23(1):157.