Anti CALCOCO1 pAb (ATL-HPA038314 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038314-25

• 
• 
• 

Protein Description: calcium binding and coiled-coil domain 1
Gene Name: CALCOCO1
Alternative Gene Name: calphoglin, Cocoa, KIAA1536
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023055: 87%, ENSRNOG00000048982: 89%
Entrez Gene ID: 57658
Uniprot ID: Q9P1Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAEDEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFF
• Gene Sequence: EAEDEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFF
• Gene ID - Mouse: ENSMUSG00000023055
• Gene ID - Rat: ENSRNOG00000048982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALCOCO1 pAb (ATL-HPA038314 w/enhanced validation) – 3 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Nthiga, Thaddaeus Mutugi; Kumar Shrestha, Birendra; Sjøttem, Eva; Bruun, Jack-Ansgar; Bowitz Larsen, Kenneth; Bhujabal, Zambarlal; Lamark, Trond; Johansen, Terje. CALCOCO1 acts with VAMP-associated proteins to mediate ER-phagy. The Embo Journal. 2020;39(15):e103649. 

Nthiga, Thaddaeus Mutugi; Shrestha, Birendra Kumar; Bruun, Jack-Ansgar; Larsen, Kenneth Bowitz; Lamark, Trond; Johansen, Terje. Regulation of Golgi turnover by CALCOCO1-mediated selective autophagy. The Journal Of Cell Biology. 2021;220(6)