Anti CALCOCO1 pAb (ATL-HPA038313 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038313-25

• 
• 
• 

Protein Description: calcium binding and coiled-coil domain 1
Gene Name: CALCOCO1
Alternative Gene Name: calphoglin, Cocoa, KIAA1536
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023055: 82%, ENSRNOG00000048982: 83%
Entrez Gene ID: 57658
Uniprot ID: Q9P1Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHL
• Gene Sequence: EHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTISEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHL
• Gene ID - Mouse: ENSMUSG00000023055
• Gene ID - Rat: ENSRNOG00000048982
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.