Anti CALB2 pAb (ATL-HPA007306 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007306-25

• 
• 
• 

Protein Description: calbindin 2
Gene Name: CALB2
Alternative Gene Name: CAL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003657: 100%, ENSRNOG00000016977: 100%
Entrez Gene ID: 794
Uniprot ID: P22676
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKY
• Gene Sequence: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKY
• Gene ID - Mouse: ENSMUSG00000003657
• Gene ID - Rat: ENSRNOG00000016977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALB2 pAb (ATL-HPA007306 w/enhanced validation) – 3 Found

Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. 

Kresoja-Rakic, Jelena; Kapaklikaya, Esra; Ziltener, Gabriela; Dalcher, Damian; Santoro, Raffaella; Christensen, Brock C; Johnson, Kevin C; Schwaller, Beat; Weder, Walter; Stahel, Rolf A; Felley-Bosco, Emanuela. Identification of cis- and trans-acting elements regulating calretinin expression in mesothelioma cells. Oncotarget. 2016;7(16):21272-86. 

Oehl, Kathrin; Kresoja-Rakic, Jelena; Opitz, Isabelle; Vrugt, Bart; Weder, Walter; Stahel, Rolf; Wild, Peter; Felley-Bosco, Emanuela. Live-Cell Mesothelioma Biobank to Explore Mechanisms of Tumor Progression. Frontiers In Oncology. 8( 29527515):40.