Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA007305-25
  • Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA007305 antibody. Corresponding CALB2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CALB2 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: calbindin 2
Gene Name: CALB2
Alternative Gene Name: CAL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003657: 98%, ENSRNOG00000016977: 98%
Entrez Gene ID: 794
Uniprot ID: P22676
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Gene Sequence LKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLLPVQENFLLKFQGMKLTSEEFNAIFTFYDKDRSGYIDEHELDALLKDLYEKNKKEMNIQQLTNYRKSVMSLAEAGKLYRKDLEIV
Gene ID - Mouse ENSMUSG00000003657
Gene ID - Rat ENSRNOG00000016977
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation)
Datasheet Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation)
Datasheet Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation)



Citations for Anti CALB2 pAb (ATL-HPA007305 w/enhanced validation) – 2 Found
Malacrida, Beatrice; Nichols, Sam; Maniati, Eleni; Jones, Roanne; Delanie-Smith, Robin; Roozitalab, Reza; Tyler, Eleanor J; Thomas, Morgan; Boot, Gina; Mackerodt, Jonas; Lockley, Michelle; Knight, Martin M; Balkwill, Frances R; Pearce, Oliver M T. A human multi-cellular model shows how platelets drive production of diseased extracellular matrix and tissue invasion. Iscience. 2021;24(6):102676.  PubMed
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.  PubMed