Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056734-25
  • Immunohistochemistry analysis in human kidney and skeletal muscle tissues using HPA056734 antibody. Corresponding CALB1 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calbindin 1, 28kDa
Gene Name: CALB1
Alternative Gene Name: CALB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028222: 100%, ENSRNOG00000007456: 100%
Entrez Gene ID: 793
Uniprot ID: P05937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT
Gene Sequence IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT
Gene ID - Mouse ENSMUSG00000028222
Gene ID - Rat ENSRNOG00000007456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation)
Datasheet Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation)
Datasheet Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation)