Anti CALB1 pAb (ATL-HPA056734 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA056734-25

Protein Description: calbindin 1, 28kDa
Gene Name: CALB1
Alternative Gene Name: CALB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028222: 100%, ENSRNOG00000007456: 100%
Entrez Gene ID: 793
Uniprot ID: P05937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT
• Gene Sequence: IETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELT
• Gene ID - Mouse: ENSMUSG00000028222
• Gene ID - Rat: ENSRNOG00000007456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.