Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023099-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CALB1
Alternative Gene Name: CALB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028222: 98%, ENSRNOG00000007456: 99%
Entrez Gene ID: 793
Uniprot ID: P05937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQ |
| Gene Sequence | QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQ |
| Gene ID - Mouse | ENSMUSG00000028222 |
| Gene ID - Rat | ENSRNOG00000007456 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) | |
| Datasheet | Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) | |
| Datasheet | Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) |
| Citations for Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) – 3 Found |
| Tao, Yunlong; Vermilyea, Scott C; Zammit, Matthew; Lu, Jianfeng; Olsen, Miles; Metzger, Jeanette M; Yao, Lin; Chen, Yuejun; Phillips, Sean; Holden, James E; Bondarenko, Viktoriya; Block, Walter F; Barnhart, Todd E; Schultz-Darken, Nancy; Brunner, Kevin; Simmons, Heather; Christian, Bradley T; Emborg, Marina E; Zhang, Su-Chun. Autologous transplant therapy alleviates motor and depressive behaviors in parkinsonian monkeys. Nature Medicine. 2021;27(4):632-639. PubMed |
| Nery, Flávia C; Siranosian, Jennifer J; Rosales, Ivy; Deguise, Marc-Olivier; Sharma, Amita; Muhtaseb, Abdurrahman W; Nwe, Pann; Johnstone, Alec J; Zhang, Ren; Fatouraei, Maryam; Huemer, Natassja; Alves, Christiano R R; Kothary, Rashmi; Swoboda, Kathryn J. Impaired kidney structure and function in spinal muscular atrophy. Neurology. Genetics. 2019;5(5):e353. PubMed |
| Liang, Chang-Yu; Li, Zu-Yun; Gan, Ting-Qing; Fang, Ye-Ying; Gan, Bin-Liang; Chen, Wen-Jie; Dang, Yi-Wu; Shi, Ke; Feng, Zhen-Bo; Chen, Gang. Downregulation of hsa-microRNA-204-5p and identification of its potential regulatory network in non-small cell lung cancer: RT-qPCR, bioinformatic- and meta-analyses. Respiratory Research. 2020;21(1):60. PubMed |