Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023099-25

Protein Description: calbindin 1, 28kDa
Gene Name: CALB1
Alternative Gene Name: CALB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028222: 98%, ENSRNOG00000007456: 99%
Entrez Gene ID: 793
Uniprot ID: P05937
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQ
• Gene Sequence: QSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQ
• Gene ID - Mouse: ENSMUSG00000028222
• Gene ID - Rat: ENSRNOG00000007456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CALB1 pAb (ATL-HPA023099 w/enhanced validation) – 3 Found

Tao, Yunlong; Vermilyea, Scott C; Zammit, Matthew; Lu, Jianfeng; Olsen, Miles; Metzger, Jeanette M; Yao, Lin; Chen, Yuejun; Phillips, Sean; Holden, James E; Bondarenko, Viktoriya; Block, Walter F; Barnhart, Todd E; Schultz-Darken, Nancy; Brunner, Kevin; Simmons, Heather; Christian, Bradley T; Emborg, Marina E; Zhang, Su-Chun. Autologous transplant therapy alleviates motor and depressive behaviors in parkinsonian monkeys. Nature Medicine. 2021;27(4):632-639. 

Nery, Flávia C; Siranosian, Jennifer J; Rosales, Ivy; Deguise, Marc-Olivier; Sharma, Amita; Muhtaseb, Abdurrahman W; Nwe, Pann; Johnstone, Alec J; Zhang, Ren; Fatouraei, Maryam; Huemer, Natassja; Alves, Christiano R R; Kothary, Rashmi; Swoboda, Kathryn J. Impaired kidney structure and function in spinal muscular atrophy. Neurology. Genetics. 2019;5(5):e353. 

Liang, Chang-Yu; Li, Zu-Yun; Gan, Ting-Qing; Fang, Ye-Ying; Gan, Bin-Liang; Chen, Wen-Jie; Dang, Yi-Wu; Shi, Ke; Feng, Zhen-Bo; Chen, Gang. Downregulation of hsa-microRNA-204-5p and identification of its potential regulatory network in non-small cell lung cancer: RT-qPCR, bioinformatic- and meta-analyses. Respiratory Research. 2020;21(1):60.