Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA012612-25
  • Immunohistochemistry analysis in human cerebral cortex and lymph node tissues using HPA012612 antibody. Corresponding CADM4 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & nuclear membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell adhesion molecule 4
Gene Name: CADM4
Alternative Gene Name: IGSF4C, Necl-4, SynCAM4, TSLL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054793: 98%, ENSRNOG00000024243: 98%
Entrez Gene ID: 199731
Uniprot ID: Q8NFZ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
Gene Sequence GGIIICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEASNKHGHARALYVLVVYDPGAVVEAQTSVPY
Gene ID - Mouse ENSMUSG00000054793
Gene ID - Rat ENSRNOG00000024243
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation)
Datasheet Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation)
Datasheet Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CADM4 pAb (ATL-HPA012612 w/enhanced validation)