Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA002981-25
  • Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA002981 antibody. Corresponding CADM3 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell adhesion molecule 3
Gene Name: CADM3
Alternative Gene Name: BIgR, FLJ10698, IGSF4B, Necl-1, NECL1, SynCAM3, TSLL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005338: 95%, ENSRNOG00000003365: 93%
Entrez Gene ID: 57863
Uniprot ID: Q8N126
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Gene Sequence QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Gene ID - Mouse ENSMUSG00000005338
Gene ID - Rat ENSRNOG00000003365
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation)
Datasheet Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation)
Datasheet Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CADM3 pAb (ATL-HPA002981 w/enhanced validation)