Anti CACYBP pAb (ATL-HPA057038)

Atlas Antibodies

Catalog No.:
ATL-HPA057038-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcyclin binding protein
Gene Name: CACYBP
Alternative Gene Name: S100A6BP, SIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014226: 94%, ENSRNOG00000002572: 94%
Entrez Gene ID: 27101
Uniprot ID: Q9HB71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGD
Gene Sequence CRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGD
Gene ID - Mouse ENSMUSG00000014226
Gene ID - Rat ENSRNOG00000002572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACYBP pAb (ATL-HPA057038)
Datasheet Anti CACYBP pAb (ATL-HPA057038) Datasheet (External Link)
Vendor Page Anti CACYBP pAb (ATL-HPA057038) at Atlas Antibodies

Documents & Links for Anti CACYBP pAb (ATL-HPA057038)
Datasheet Anti CACYBP pAb (ATL-HPA057038) Datasheet (External Link)
Vendor Page Anti CACYBP pAb (ATL-HPA057038)