Anti CACYBP pAb (ATL-HPA025753)

Atlas Antibodies

SKU: ATL-HPA025753-25

• 
• 
• 

Protein Description: calcyclin binding protein
Gene Name: CACYBP
Alternative Gene Name: S100A6BP, SIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014226: 84%, ENSRNOG00000002572: 83%
Entrez Gene ID: 27101
Uniprot ID: Q9HB71
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
• Gene Sequence: MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITT
• Gene ID - Mouse: ENSMUSG00000014226
• Gene ID - Rat: ENSRNOG00000002572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.