Anti CACTIN pAb (ATL-HPA042548)

Atlas Antibodies

Catalog No.:
ATL-HPA042548-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cactin, spliceosome C complex subunit
Gene Name: CACTIN
Alternative Gene Name: C19orf29, cactin, fSAPc, NY-REN-24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034889: 94%, ENSRNOG00000039852: 94%
Entrez Gene ID: 58509
Uniprot ID: Q8WUQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG
Gene Sequence SLDDYDAGRYSPRLLTAHELPLDAHVLEPDEDLQRLQLSRQQLQVTGDASESAEDIFFRRAKEGMGQDEAQFSVEMPLTG
Gene ID - Mouse ENSMUSG00000034889
Gene ID - Rat ENSRNOG00000039852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACTIN pAb (ATL-HPA042548)
Datasheet Anti CACTIN pAb (ATL-HPA042548) Datasheet (External Link)
Vendor Page Anti CACTIN pAb (ATL-HPA042548) at Atlas Antibodies

Documents & Links for Anti CACTIN pAb (ATL-HPA042548)
Datasheet Anti CACTIN pAb (ATL-HPA042548) Datasheet (External Link)
Vendor Page Anti CACTIN pAb (ATL-HPA042548)