Anti CACTIN pAb (ATL-HPA042504)

Atlas Antibodies

Catalog No.: ATL-HPA042504-25

Protein Description: cactin, spliceosome C complex subunit
Gene Name: CACTIN
Alternative Gene Name: C19orf29, cactin, fSAPc, NY-REN-24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034889: 96%, ENSRNOG00000039852: 96%
Entrez Gene ID: 58509
Uniprot ID: Q8WUQ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFH
• Gene Sequence: TGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPDLIDKRSTPEYFLEACADNKDFAILRFHAGPPYEDIAFKIVNREWEYSHRHGFRCQFANGIFQLWFH
• Gene ID - Mouse: ENSMUSG00000034889
• Gene ID - Rat: ENSRNOG00000039852
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.