Anti CACNG5 pAb (ATL-HPA050115)

Atlas Antibodies

Catalog No.:
ATL-HPA050115-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium channel, voltage-dependent, gamma subunit 5
Gene Name: CACNG5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040373: 95%, ENSRNOG00000003288: 95%
Entrez Gene ID: 27091
Uniprot ID: Q9UF02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRS
Gene Sequence WRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRS
Gene ID - Mouse ENSMUSG00000040373
Gene ID - Rat ENSRNOG00000003288
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACNG5 pAb (ATL-HPA050115)
Datasheet Anti CACNG5 pAb (ATL-HPA050115) Datasheet (External Link)
Vendor Page Anti CACNG5 pAb (ATL-HPA050115) at Atlas Antibodies

Documents & Links for Anti CACNG5 pAb (ATL-HPA050115)
Datasheet Anti CACNG5 pAb (ATL-HPA050115) Datasheet (External Link)
Vendor Page Anti CACNG5 pAb (ATL-HPA050115)