Anti CACNG5 pAb (ATL-HPA050115)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050115-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CACNG5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040373: 95%, ENSRNOG00000003288: 95%
Entrez Gene ID: 27091
Uniprot ID: Q9UF02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRS |
Gene Sequence | WRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRS |
Gene ID - Mouse | ENSMUSG00000040373 |
Gene ID - Rat | ENSRNOG00000003288 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CACNG5 pAb (ATL-HPA050115) | |
Datasheet | Anti CACNG5 pAb (ATL-HPA050115) Datasheet (External Link) |
Vendor Page | Anti CACNG5 pAb (ATL-HPA050115) at Atlas Antibodies |
Documents & Links for Anti CACNG5 pAb (ATL-HPA050115) | |
Datasheet | Anti CACNG5 pAb (ATL-HPA050115) Datasheet (External Link) |
Vendor Page | Anti CACNG5 pAb (ATL-HPA050115) |