Anti CACNG4 pAb (ATL-HPA005803 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA005803-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-CACNG4 antibody. Corresponding CACNG4 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium channel, voltage-dependent, gamma subunit 4
Gene Name: CACNG4
Alternative Gene Name: MGC11138, MGC24983
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020723: 99%, ENSRNOG00000003262: 100%
Entrez Gene ID: 27092
Uniprot ID: Q9UBN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSV
Gene Sequence TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSV
Gene ID - Mouse ENSMUSG00000020723
Gene ID - Rat ENSRNOG00000003262
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CACNG4 pAb (ATL-HPA005803 w/enhanced validation)
Datasheet Anti CACNG4 pAb (ATL-HPA005803 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CACNG4 pAb (ATL-HPA005803 w/enhanced validation)