Anti CACNB2 pAb (ATL-HPA035326 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA035326-25

• 

Protein Description: calcium channel, voltage-dependent, beta 2 subunit
Gene Name: CACNB2
Alternative Gene Name: CACNLB2, MYSB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057914: 81%, ENSRNOG00000018378: 78%
Entrez Gene ID: 783
Uniprot ID: Q08289
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI
• Gene Sequence: RDSAYVEPKEDYSHDHVDHYASHRDHNHRDETHGSSDHRHRESRHRSRDVDREQDHNECNKQRSRHKSKDRYCEKDGEVI
• Gene ID - Mouse: ENSMUSG00000057914
• Gene ID - Rat: ENSRNOG00000018378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.