Anti CACNB1 pAb (ATL-HPA023343)

Atlas Antibodies

SKU:
ATL-HPA023343-25
  • Immunohistochemical staining of human cerebellum shows strong positivity in neuronal cells and projections in molecular layer.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcium channel, voltage-dependent, beta 1 subunit
Gene Name: CACNB1
Alternative Gene Name: CACNLB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020882: 95%, ENSRNOG00000004518: 95%
Entrez Gene ID: 782
Uniprot ID: Q02641
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Gene Sequence GSRNSAYTELGDSCVDMETDPSEGPGLGDPAGGGTPPARQGSWEDEEEDYEEELTDNRNRGRNKARYCAEGGGPVLGRNKNELEGWGRGVYIR
Gene ID - Mouse ENSMUSG00000020882
Gene ID - Rat ENSRNOG00000004518
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CACNB1 pAb (ATL-HPA023343)
Datasheet Anti CACNB1 pAb (ATL-HPA023343) Datasheet (External Link)
Vendor Page Anti CACNB1 pAb (ATL-HPA023343) at Atlas Antibodies

Documents & Links for Anti CACNB1 pAb (ATL-HPA023343)
Datasheet Anti CACNB1 pAb (ATL-HPA023343) Datasheet (External Link)
Vendor Page Anti CACNB1 pAb (ATL-HPA023343)