Anti CACNA2D4 pAb (ATL-HPA031952)

Atlas Antibodies

SKU: ATL-HPA031952-25

• 

Protein Description: calcium channel, voltage-dependent, alpha 2/delta subunit 4
Gene Name: CACNA2D4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041460: 91%, ENSRNOG00000008031: 90%
Entrez Gene ID: 93589
Uniprot ID: Q7Z3S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM
• Gene Sequence: NDFINIIAYNDYVHYIEPCFKGILVQADRDNREHFKLLVEELMVKGVGVVDQALREAFQILKQFQEAKQGSLCNQAIM
• Gene ID - Mouse: ENSMUSG00000041460
• Gene ID - Rat: ENSRNOG00000008031
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CACNA2D4 pAb (ATL-HPA031952) – 1 Found

De Sevilla Müller, Luis Pérez; Liu, Janelle; Solomon, Alexander; Rodriguez, Allen; Brecha, Nicholas C. Expression of voltage-gated calcium channel α(2)δ(4) subunits in the mouse and rat retina. The Journal Of Comparative Neurology. 2013;521(11):2486-501.