Anti CACNA1S pAb (ATL-HPA056815 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056815-25
  • Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-CACNA1S antibody. Corresponding CACNA1S RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcium channel, voltage-dependent, L type, alpha 1S subunit
Gene Name: CACNA1S
Alternative Gene Name: CACNL1A3, Cav1.1, HOKPP, hypoPP, MHS5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026407: 91%, ENSRNOG00000046231: 96%
Entrez Gene ID: 779
Uniprot ID: Q13698
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL
Gene Sequence EEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAEL
Gene ID - Mouse ENSMUSG00000026407
Gene ID - Rat ENSRNOG00000046231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CACNA1S pAb (ATL-HPA056815 w/enhanced validation)
Datasheet Anti CACNA1S pAb (ATL-HPA056815 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CACNA1S pAb (ATL-HPA056815 w/enhanced validation)