Anti CACNA1F pAb (ATL-HPA068379)

Atlas Antibodies

Catalog No.:
ATL-HPA068379-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: calcium voltage-gated channel subunit alpha1 F
Gene Name: CACNA1F
Alternative Gene Name: AIED, Cav1.4, CORDX3, CSNB2, CSNB2A, CSNBX2, JM8, JMC8, OA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031142: 82%, ENSRNOG00000010348: 83%
Entrez Gene ID: 778
Uniprot ID: O60840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
Gene Sequence SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH
Gene ID - Mouse ENSMUSG00000031142
Gene ID - Rat ENSRNOG00000010348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACNA1F pAb (ATL-HPA068379)
Datasheet Anti CACNA1F pAb (ATL-HPA068379) Datasheet (External Link)
Vendor Page Anti CACNA1F pAb (ATL-HPA068379) at Atlas Antibodies

Documents & Links for Anti CACNA1F pAb (ATL-HPA068379)
Datasheet Anti CACNA1F pAb (ATL-HPA068379) Datasheet (External Link)
Vendor Page Anti CACNA1F pAb (ATL-HPA068379)