Anti CACNA1D pAb (ATL-HPA020215)

Atlas Antibodies

SKU: ATL-HPA020215-25

• 
• 

Protein Description: calcium channel, voltage-dependent, L type, alpha 1D subunit
Gene Name: CACNA1D
Alternative Gene Name: CACH3, CACN4, CACNL1A2, Cav1.3, CCHL1A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015968: 87%, ENSRNOG00000013147: 85%
Entrez Gene ID: 776
Uniprot ID: Q01668
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAV
• Gene Sequence: EDPEIHGYFRDPHCLGEQEYFSSEECYEDDSSPTWSRQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAV
• Gene ID - Mouse: ENSMUSG00000015968
• Gene ID - Rat: ENSRNOG00000013147
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CACNA1D pAb (ATL-HPA020215) – 7 Found

Radhakrishnan, Vijayababu M; Gilpatrick, Maryam M; Parsa, Nour Alhoda; Kiela, Pawel R; Ghishan, Fayez K. Expression of Cav1.3 calcium channel in the human and mouse colon: posttranscriptional inhibition by IFNγ. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2017;312(1):G77-G84. 

Zou, Junhuang; Lee, Amy; Yang, Jun. The expression of whirlin and Cav1.3α₁ is mutually independent in photoreceptors. Vision Research. 2012;75( 22892111):53-9. 

Scholl, Ute I; Goh, Gerald; Stölting, Gabriel; de Oliveira, Regina Campos; Choi, Murim; Overton, John D; Fonseca, Annabelle L; Korah, Reju; Starker, Lee F; Kunstman, John W; Prasad, Manju L; Hartung, Erum A; Mauras, Nelly; Benson, Matthew R; Brady, Tammy; Shapiro, Jay R; Loring, Erin; Nelson-Williams, Carol; Libutti, Steven K; Mane, Shrikant; Hellman, Per; Westin, Gunnar; Åkerström, Göran; Björklund, Peyman; Carling, Tobias; Fahlke, Christoph; Hidalgo, Patricia; Lifton, Richard P. Somatic and germline CACNA1D calcium channel mutations in aldosterone-producing adenomas and primary aldosteronism. Nature Genetics. 2013;45(9):1050-4. 

Jacquemet, Guillaume; Baghirov, Habib; Georgiadou, Maria; Sihto, Harri; Peuhu, Emilia; Cettour-Janet, Pierre; He, Tao; Perälä, Merja; Kronqvist, Pauliina; Joensuu, Heikki; Ivaska, Johanna. L-type calcium channels regulate filopodia stability and cancer cell invasion downstream of integrin signalling. Nature Communications. 2016;7( 27910855):13297. 

Fourbon, Yann; Guéguinou, Maxime; Félix, Romain; Constantin, Bruno; Uguen, Arnaud; Fromont, Gaëlle; Lajoie, Laurie; Magaud, Christophe; Lecomte, Thierry; Chamorey, Emmanuel; Chatelier, Aurélien; Mignen, Olivier; Potier-Cartereau, Marie; Chantôme, Aurélie; Bois, Patrick; Vandier, Christophe. Ca(2+) protein alpha 1D of CaV1.3 regulates intracellular calcium concentration and migration of colon cancer cells through a non-canonical activity. Scientific Reports. 2017;7(1):14199. 

Hosoya, Makoto; Fujioka, Masato; Murayama, Ayako Y; Ozawa, Hiroyuki; Okano, Hideyuki; Ogawa, Kaoru. Neuronal development in the cochlea of a nonhuman primate model, the common marmoset. Developmental Neurobiology. 2021;81(8):905-938. 

Zhang, Gong; Liu, Jun-Bin; Yuan, He-Lan; Chen, Si-Yun; Singer, Joshua H; Ke, Jiang-Bin. Multiple Calcium Channel Types with Unique Expression Patterns Mediate Retinal Signaling at Bipolar Cell Ribbon Synapses. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2022;42(34):6487-6505.