Anti CACNA1B pAb (ATL-HPA044347)

Atlas Antibodies

Catalog No.: ATL-HPA044347-25

Protein Description: calcium channel, voltage-dependent, N type, alpha 1B subunit
Gene Name: CACNA1B
Alternative Gene Name: CACNL1A5, CACNN, Cav2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004113: 93%, ENSRNOG00000004560: 91%
Entrez Gene ID: 774
Uniprot ID: Q00975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
• Gene Sequence: ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
• Gene ID - Mouse: ENSMUSG00000004113
• Gene ID - Rat: ENSRNOG00000004560
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CACNA1B pAb (ATL-HPA044347) – 2 Found

Liu, Zhen; Wang, Fei; Fischer, Gregory; Hogan, Quinn H; Yu, Hongwei. Peripheral nerve injury induces loss of nociceptive neuron-specific Gαi-interacting protein in neuropathic pain rat. Molecular Pain. 12( 27145804) 

Poillot, Philip; Snuggs, Joseph W; Le Maitre, Christine L; Huyghe, Jacques M. L-type Voltage-Gated calcium channels partly mediate Mechanotransduction in the intervertebral disc. Jor Spine. 2022;5(4):e1213.