Anti CACNA1B pAb (ATL-HPA044347)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044347-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CACNA1B
Alternative Gene Name: CACNL1A5, CACNN, Cav2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004113: 93%, ENSRNOG00000004560: 91%
Entrez Gene ID: 774
Uniprot ID: Q00975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE |
| Gene Sequence | ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE |
| Gene ID - Mouse | ENSMUSG00000004113 |
| Gene ID - Rat | ENSRNOG00000004560 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CACNA1B pAb (ATL-HPA044347) | |
| Datasheet | Anti CACNA1B pAb (ATL-HPA044347) Datasheet (External Link) |
| Vendor Page | Anti CACNA1B pAb (ATL-HPA044347) at Atlas Antibodies |
| Documents & Links for Anti CACNA1B pAb (ATL-HPA044347) | |
| Datasheet | Anti CACNA1B pAb (ATL-HPA044347) Datasheet (External Link) |
| Vendor Page | Anti CACNA1B pAb (ATL-HPA044347) |
| Citations for Anti CACNA1B pAb (ATL-HPA044347) – 2 Found |
| Liu, Zhen; Wang, Fei; Fischer, Gregory; Hogan, Quinn H; Yu, Hongwei. Peripheral nerve injury induces loss of nociceptive neuron-specific Gαi-interacting protein in neuropathic pain rat. Molecular Pain. 12( 27145804) PubMed |
| Poillot, Philip; Snuggs, Joseph W; Le Maitre, Christine L; Huyghe, Jacques M. L-type Voltage-Gated calcium channels partly mediate Mechanotransduction in the intervertebral disc. Jor Spine. 2022;5(4):e1213. PubMed |