Anti CACNA1B pAb (ATL-HPA044347)

Atlas Antibodies

Catalog No.:
ATL-HPA044347-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calcium channel, voltage-dependent, N type, alpha 1B subunit
Gene Name: CACNA1B
Alternative Gene Name: CACNL1A5, CACNN, Cav2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004113: 93%, ENSRNOG00000004560: 91%
Entrez Gene ID: 774
Uniprot ID: Q00975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Gene Sequence ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Gene ID - Mouse ENSMUSG00000004113
Gene ID - Rat ENSRNOG00000004560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACNA1B pAb (ATL-HPA044347)
Datasheet Anti CACNA1B pAb (ATL-HPA044347) Datasheet (External Link)
Vendor Page Anti CACNA1B pAb (ATL-HPA044347) at Atlas Antibodies

Documents & Links for Anti CACNA1B pAb (ATL-HPA044347)
Datasheet Anti CACNA1B pAb (ATL-HPA044347) Datasheet (External Link)
Vendor Page Anti CACNA1B pAb (ATL-HPA044347)
Citations for Anti CACNA1B pAb (ATL-HPA044347) – 2 Found
Liu, Zhen; Wang, Fei; Fischer, Gregory; Hogan, Quinn H; Yu, Hongwei. Peripheral nerve injury induces loss of nociceptive neuron-specific Gαi-interacting protein in neuropathic pain rat. Molecular Pain. 12( 27145804)  PubMed
Poillot, Philip; Snuggs, Joseph W; Le Maitre, Christine L; Huyghe, Jacques M. L-type Voltage-Gated calcium channels partly mediate Mechanotransduction in the intervertebral disc. Jor Spine. 2022;5(4):e1213.  PubMed