Anti CACNA1B pAb (ATL-HPA022919)

Atlas Antibodies

Catalog No.:
ATL-HPA022919-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium voltage-gated channel subunit alpha1 B
Gene Name: CACNA1B
Alternative Gene Name: CACNL1A5, CACNN, Cav2.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004113: 93%, ENSRNOG00000004560: 91%
Entrez Gene ID: 774
Uniprot ID: Q00975
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Gene Sequence ALMIFDFYKQNKTTRDQMQQAPGGLSQMGPVSLFHPLKATLEQTQPAVLRGARVFLRQKSSTSLSNGGAIQNQESGIKESVSWGTQRTQDAPHE
Gene ID - Mouse ENSMUSG00000004113
Gene ID - Rat ENSRNOG00000004560
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CACNA1B pAb (ATL-HPA022919)
Datasheet Anti CACNA1B pAb (ATL-HPA022919) Datasheet (External Link)
Vendor Page Anti CACNA1B pAb (ATL-HPA022919) at Atlas Antibodies

Documents & Links for Anti CACNA1B pAb (ATL-HPA022919)
Datasheet Anti CACNA1B pAb (ATL-HPA022919) Datasheet (External Link)
Vendor Page Anti CACNA1B pAb (ATL-HPA022919)