Anti CACFD1 pAb (ATL-HPA015280 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA015280-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CACFD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413631).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: calcium channel flower domain containing 1
Gene Name: CACFD1
Alternative Gene Name: C9orf7, D9S2135, flower
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015488: 98%, ENSRNOG00000005840: 98%
Entrez Gene ID: 11094
Uniprot ID: Q9UGQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Gene Sequence NAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETLE
Gene ID - Mouse ENSMUSG00000015488
Gene ID - Rat ENSRNOG00000005840
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CACFD1 pAb (ATL-HPA015280 w/enhanced validation)
Datasheet Anti CACFD1 pAb (ATL-HPA015280 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CACFD1 pAb (ATL-HPA015280 w/enhanced validation)