Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA044016-25
  • Immunohistochemistry analysis in human testis and fallopian tube tissues using Anti-CABS1 antibody. Corresponding CABS1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcium-binding protein, spermatid-specific 1
Gene Name: CABS1
Alternative Gene Name: C4orf35, CLPH, FLJ32897, NYD-SP26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007907: 58%, ENSRNOG00000001950: 59%
Entrez Gene ID: 85438
Uniprot ID: Q96KC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVP
Gene Sequence GTTNSITRDSITEHFMPVKIGNISSPVTTVSLIDFSTDIAKEDILLATIDTGDAEISITSEVSGTLKDSSAGVADAPAFPRKKDEADMSNYNSSIKSNVP
Gene ID - Mouse ENSMUSG00000007907
Gene ID - Rat ENSRNOG00000001950
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation)
Datasheet Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation)
Datasheet Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CABS1 pAb (ATL-HPA044016 w/enhanced validation)