Anti CABP1 pAb (ATL-HPA051438)

Atlas Antibodies

Catalog No.:
ATL-HPA051438-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: calcium binding protein 1
Gene Name: CABP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029544: 84%, ENSRNOG00000001173: 85%
Entrez Gene ID: 9478
Uniprot ID: Q9NZU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNCVKYPLRNLSRKMCQEEQTSYMVVQTSEEGLAADAELPGPLLMLAQNCAVMHNLLGPACI
Gene Sequence GNCVKYPLRNLSRKMCQEEQTSYMVVQTSEEGLAADAELPGPLLMLAQNCAVMHNLLGPACI
Gene ID - Mouse ENSMUSG00000029544
Gene ID - Rat ENSRNOG00000001173
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CABP1 pAb (ATL-HPA051438)
Datasheet Anti CABP1 pAb (ATL-HPA051438) Datasheet (External Link)
Vendor Page Anti CABP1 pAb (ATL-HPA051438) at Atlas Antibodies

Documents & Links for Anti CABP1 pAb (ATL-HPA051438)
Datasheet Anti CABP1 pAb (ATL-HPA051438) Datasheet (External Link)
Vendor Page Anti CABP1 pAb (ATL-HPA051438)