Anti CABLES2 pAb (ATL-HPA052138)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052138-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CABLES2
Alternative Gene Name: C20orf150, dJ908M14.2, ik3-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%
Entrez Gene ID: 81928
Uniprot ID: Q9BTV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN |
Gene Sequence | AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN |
Gene ID - Mouse | ENSMUSG00000038990 |
Gene ID - Rat | ENSRNOG00000051420 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CABLES2 pAb (ATL-HPA052138) | |
Datasheet | Anti CABLES2 pAb (ATL-HPA052138) Datasheet (External Link) |
Vendor Page | Anti CABLES2 pAb (ATL-HPA052138) at Atlas Antibodies |
Documents & Links for Anti CABLES2 pAb (ATL-HPA052138) | |
Datasheet | Anti CABLES2 pAb (ATL-HPA052138) Datasheet (External Link) |
Vendor Page | Anti CABLES2 pAb (ATL-HPA052138) |