Anti CABLES2 pAb (ATL-HPA052138)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052138-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CABLES2
Alternative Gene Name: C20orf150, dJ908M14.2, ik3-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%
Entrez Gene ID: 81928
Uniprot ID: Q9BTV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN |
| Gene Sequence | AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN |
| Gene ID - Mouse | ENSMUSG00000038990 |
| Gene ID - Rat | ENSRNOG00000051420 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CABLES2 pAb (ATL-HPA052138) | |
| Datasheet | Anti CABLES2 pAb (ATL-HPA052138) Datasheet (External Link) |
| Vendor Page | Anti CABLES2 pAb (ATL-HPA052138) at Atlas Antibodies |
| Documents & Links for Anti CABLES2 pAb (ATL-HPA052138) | |
| Datasheet | Anti CABLES2 pAb (ATL-HPA052138) Datasheet (External Link) |
| Vendor Page | Anti CABLES2 pAb (ATL-HPA052138) |