Anti CABLES2 pAb (ATL-HPA052138)

Atlas Antibodies

Catalog No.:
ATL-HPA052138-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Cdk5 and Abl enzyme substrate 2
Gene Name: CABLES2
Alternative Gene Name: C20orf150, dJ908M14.2, ik3-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%
Entrez Gene ID: 81928
Uniprot ID: Q9BTV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Gene Sequence AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN
Gene ID - Mouse ENSMUSG00000038990
Gene ID - Rat ENSRNOG00000051420
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CABLES2 pAb (ATL-HPA052138)
Datasheet Anti CABLES2 pAb (ATL-HPA052138) Datasheet (External Link)
Vendor Page Anti CABLES2 pAb (ATL-HPA052138) at Atlas Antibodies

Documents & Links for Anti CABLES2 pAb (ATL-HPA052138)
Datasheet Anti CABLES2 pAb (ATL-HPA052138) Datasheet (External Link)
Vendor Page Anti CABLES2 pAb (ATL-HPA052138)