Anti CABLES1 pAb (ATL-HPA073649)

Atlas Antibodies

SKU:
ATL-HPA073649-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Cdk5 and Abl enzyme substrate 1
Gene Name: CABLES1
Alternative Gene Name: FLJ35924, HsT2563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%
Entrez Gene ID: 91768
Uniprot ID: Q8TDN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN
Gene Sequence SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN
Gene ID - Mouse ENSMUSG00000040957
Gene ID - Rat ENSRNOG00000012795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CABLES1 pAb (ATL-HPA073649)
Datasheet Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link)
Vendor Page Anti CABLES1 pAb (ATL-HPA073649) at Atlas Antibodies

Documents & Links for Anti CABLES1 pAb (ATL-HPA073649)
Datasheet Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link)
Vendor Page Anti CABLES1 pAb (ATL-HPA073649)