Anti CABLES1 pAb (ATL-HPA073649)
Atlas Antibodies
- SKU:
- ATL-HPA073649-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CABLES1
Alternative Gene Name: FLJ35924, HsT2563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%
Entrez Gene ID: 91768
Uniprot ID: Q8TDN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN |
Gene Sequence | SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN |
Gene ID - Mouse | ENSMUSG00000040957 |
Gene ID - Rat | ENSRNOG00000012795 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CABLES1 pAb (ATL-HPA073649) | |
Datasheet | Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link) |
Vendor Page | Anti CABLES1 pAb (ATL-HPA073649) at Atlas Antibodies |
Documents & Links for Anti CABLES1 pAb (ATL-HPA073649) | |
Datasheet | Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link) |
Vendor Page | Anti CABLES1 pAb (ATL-HPA073649) |