Anti CABLES1 pAb (ATL-HPA073649)
Atlas Antibodies
- Catalog No.:
- ATL-HPA073649-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CABLES1
Alternative Gene Name: FLJ35924, HsT2563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040957: 94%, ENSRNOG00000012795: 92%
Entrez Gene ID: 91768
Uniprot ID: Q8TDN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN |
| Gene Sequence | SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN |
| Gene ID - Mouse | ENSMUSG00000040957 |
| Gene ID - Rat | ENSRNOG00000012795 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CABLES1 pAb (ATL-HPA073649) | |
| Datasheet | Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link) |
| Vendor Page | Anti CABLES1 pAb (ATL-HPA073649) at Atlas Antibodies |
| Documents & Links for Anti CABLES1 pAb (ATL-HPA073649) | |
| Datasheet | Anti CABLES1 pAb (ATL-HPA073649) Datasheet (External Link) |
| Vendor Page | Anti CABLES1 pAb (ATL-HPA073649) |