Anti CABIN1 pAb (ATL-HPA043296)

Atlas Antibodies

Catalog No.:
ATL-HPA043296-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: calcineurin binding protein 1
Gene Name: CABIN1
Alternative Gene Name: KIAA0330, PPP3IN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020196: 70%, ENSRNOG00000001237: 68%
Entrez Gene ID: 23523
Uniprot ID: Q9Y6J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
Gene Sequence EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE
Gene ID - Mouse ENSMUSG00000020196
Gene ID - Rat ENSRNOG00000001237
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CABIN1 pAb (ATL-HPA043296)
Datasheet Anti CABIN1 pAb (ATL-HPA043296) Datasheet (External Link)
Vendor Page Anti CABIN1 pAb (ATL-HPA043296) at Atlas Antibodies

Documents & Links for Anti CABIN1 pAb (ATL-HPA043296)
Datasheet Anti CABIN1 pAb (ATL-HPA043296) Datasheet (External Link)
Vendor Page Anti CABIN1 pAb (ATL-HPA043296)
Citations for Anti CABIN1 pAb (ATL-HPA043296) – 1 Found
Cohen, Camille; Corpet, Armelle; Roubille, Simon; Maroui, Mohamed Ali; Poccardi, Nolwenn; Rousseau, Antoine; Kleijwegt, Constance; Binda, Olivier; Texier, Pascale; Sawtell, Nancy; Labetoulle, Marc; Lomonte, Patrick. Promyelocytic leukemia (PML) nuclear bodies (NBs) induce latent/quiescent HSV-1 genomes chromatinization through a PML NB/Histone H3.3/H3.3 Chaperone Axis. Plos Pathogens. 2018;14(9):e1007313.  PubMed