Anti CABIN1 pAb (ATL-HPA043296)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043296-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CABIN1
Alternative Gene Name: KIAA0330, PPP3IN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020196: 70%, ENSRNOG00000001237: 68%
Entrez Gene ID: 23523
Uniprot ID: Q9Y6J0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE |
| Gene Sequence | EPGGKVGLLNHRPVAMDAGDSADQSGERKDKESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLE |
| Gene ID - Mouse | ENSMUSG00000020196 |
| Gene ID - Rat | ENSRNOG00000001237 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CABIN1 pAb (ATL-HPA043296) | |
| Datasheet | Anti CABIN1 pAb (ATL-HPA043296) Datasheet (External Link) |
| Vendor Page | Anti CABIN1 pAb (ATL-HPA043296) at Atlas Antibodies |
| Documents & Links for Anti CABIN1 pAb (ATL-HPA043296) | |
| Datasheet | Anti CABIN1 pAb (ATL-HPA043296) Datasheet (External Link) |
| Vendor Page | Anti CABIN1 pAb (ATL-HPA043296) |
| Citations for Anti CABIN1 pAb (ATL-HPA043296) – 1 Found |
| Cohen, Camille; Corpet, Armelle; Roubille, Simon; Maroui, Mohamed Ali; Poccardi, Nolwenn; Rousseau, Antoine; Kleijwegt, Constance; Binda, Olivier; Texier, Pascale; Sawtell, Nancy; Labetoulle, Marc; Lomonte, Patrick. Promyelocytic leukemia (PML) nuclear bodies (NBs) induce latent/quiescent HSV-1 genomes chromatinization through a PML NB/Histone H3.3/H3.3 Chaperone Axis. Plos Pathogens. 2018;14(9):e1007313. PubMed |