Anti CAAP1 pAb (ATL-HPA024029)

Atlas Antibodies

SKU:
ATL-HPA024029-100
  • Immunohistochemical staining of human Cerebellum shows moderate nuclear positivity in Purkinje cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CAAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410946).
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: caspase activity and apoptosis inhibitor 1
Gene Name: CAAP1
Alternative Gene Name: C9orf82, CAAP, FLJ13657
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028578: 95%, ENSRNOG00000000308: 25%
Entrez Gene ID: 79886
Uniprot ID: Q9H8G2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCS
Gene Sequence STDSSSVSGSLQQETKYILPTLEKELFLAEHSDLEEGGLDLTVSLKPVSFYISDKKEMLQQCFCIIGEKKLQKMLPDVLKNCS
Gene ID - Mouse ENSMUSG00000028578
Gene ID - Rat ENSRNOG00000000308
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CAAP1 pAb (ATL-HPA024029)
Datasheet Anti CAAP1 pAb (ATL-HPA024029) Datasheet (External Link)
Vendor Page Anti CAAP1 pAb (ATL-HPA024029) at Atlas Antibodies

Documents & Links for Anti CAAP1 pAb (ATL-HPA024029)
Datasheet Anti CAAP1 pAb (ATL-HPA024029) Datasheet (External Link)
Vendor Page Anti CAAP1 pAb (ATL-HPA024029)