Anti CA7 pAb (ATL-HPA047237)

Atlas Antibodies

Catalog No.:
ATL-HPA047237-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carbonic anhydrase VII
Gene Name: CA7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031883: 98%, ENSRNOG00000012371: 98%
Entrez Gene ID: 766
Uniprot ID: P43166
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVV
Gene Sequence PINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQVDFNDSDDRTVV
Gene ID - Mouse ENSMUSG00000031883
Gene ID - Rat ENSRNOG00000012371
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CA7 pAb (ATL-HPA047237)
Datasheet Anti CA7 pAb (ATL-HPA047237) Datasheet (External Link)
Vendor Page Anti CA7 pAb (ATL-HPA047237) at Atlas Antibodies

Documents & Links for Anti CA7 pAb (ATL-HPA047237)
Datasheet Anti CA7 pAb (ATL-HPA047237) Datasheet (External Link)
Vendor Page Anti CA7 pAb (ATL-HPA047237)