Anti CA5B pAb (ATL-HPA012618)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012618-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CA5B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031373: 98%, ENSRNOG00000029330: 98%
Entrez Gene ID: 11238
Uniprot ID: Q9Y2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD |
| Gene Sequence | GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD |
| Gene ID - Mouse | ENSMUSG00000031373 |
| Gene ID - Rat | ENSRNOG00000029330 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CA5B pAb (ATL-HPA012618) | |
| Datasheet | Anti CA5B pAb (ATL-HPA012618) Datasheet (External Link) |
| Vendor Page | Anti CA5B pAb (ATL-HPA012618) at Atlas Antibodies |
| Documents & Links for Anti CA5B pAb (ATL-HPA012618) | |
| Datasheet | Anti CA5B pAb (ATL-HPA012618) Datasheet (External Link) |
| Vendor Page | Anti CA5B pAb (ATL-HPA012618) |