Anti CA5B pAb (ATL-HPA012618)

Atlas Antibodies

Catalog No.:
ATL-HPA012618-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: carbonic anhydrase VB, mitochondrial
Gene Name: CA5B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031373: 98%, ENSRNOG00000029330: 98%
Entrez Gene ID: 11238
Uniprot ID: Q9Y2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD
Gene Sequence GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD
Gene ID - Mouse ENSMUSG00000031373
Gene ID - Rat ENSRNOG00000029330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CA5B pAb (ATL-HPA012618)
Datasheet Anti CA5B pAb (ATL-HPA012618) Datasheet (External Link)
Vendor Page Anti CA5B pAb (ATL-HPA012618) at Atlas Antibodies

Documents & Links for Anti CA5B pAb (ATL-HPA012618)
Datasheet Anti CA5B pAb (ATL-HPA012618) Datasheet (External Link)
Vendor Page Anti CA5B pAb (ATL-HPA012618)