Anti CA3 pAb (ATL-HPA026700 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026700-100
  • Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-CA3 antibody. Corresponding CA3 RNA-seq data are presented for the same tissues.
  • Western blot analysis using Anti-CA3 antibody HPA026700 (A) shows similar pattern to independent antibody HPA021775 (B).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: carbonic anhydrase III, muscle specific
Gene Name: CA3
Alternative Gene Name: CAIII, Car3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027559: 92%, ENSRNOG00000010079: 92%
Entrez Gene ID: 761
Uniprot ID: P07451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Gene Sequence YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
Gene ID - Mouse ENSMUSG00000027559
Gene ID - Rat ENSRNOG00000010079
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CA3 pAb (ATL-HPA026700 w/enhanced validation)
Datasheet Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CA3 pAb (ATL-HPA026700 w/enhanced validation)
Datasheet Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CA3 pAb (ATL-HPA026700 w/enhanced validation)



Citations for Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) – 2 Found
Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.  PubMed
Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517.  PubMed