Anti CA3 pAb (ATL-HPA026700 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026700-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CA3
Alternative Gene Name: CAIII, Car3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027559: 92%, ENSRNOG00000010079: 92%
Entrez Gene ID: 761
Uniprot ID: P07451
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK |
| Gene Sequence | YWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK |
| Gene ID - Mouse | ENSMUSG00000027559 |
| Gene ID - Rat | ENSRNOG00000010079 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) | |
| Datasheet | Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) | |
| Datasheet | Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) |
| Citations for Anti CA3 pAb (ATL-HPA026700 w/enhanced validation) – 2 Found |
| Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. PubMed |
| Signorelli, Mirko; Ayoglu, Burcu; Johansson, Camilla; Lochmüller, Hanns; Straub, Volker; Muntoni, Francesco; Niks, Erik; Tsonaka, Roula; Persson, Anja; Aartsma-Rus, Annemieke; Nilsson, Peter; Al-Khalili Szigyarto, Cristina; Spitali, Pietro. Longitudinal serum biomarker screening identifies malate dehydrogenase 2 as candidate prognostic biomarker for Duchenne muscular dystrophy. Journal Of Cachexia, Sarcopenia And Muscle. 2020;11(2):505-517. PubMed |