Anti CA13 pAb (ATL-HPA024689 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024689-100

• 
• 

Protein Description: carbonic anhydrase XIII
Gene Name: CA13
Alternative Gene Name: CAXIII, FLJ37995, MGC59868
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027555: 94%, ENSRNOG00000021323: 95%
Entrez Gene ID: 377677
Uniprot ID: Q8N1Q1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
• Gene Sequence: EHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLR
• Gene ID - Mouse: ENSMUSG00000027555
• Gene ID - Rat: ENSRNOG00000021323
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.