Anti CA12 pAb (ATL-HPA008773)

Atlas Antibodies

Catalog No.: ATL-HPA008773-25

Protein Description: carbonic anhydrase XII
Gene Name: CA12
Alternative Gene Name: HsT18816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032373: 88%, ENSRNOG00000017766: 88%
Entrez Gene ID: 771
Uniprot ID: O43570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
• Gene Sequence: TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ
• Gene ID - Mouse: ENSMUSG00000032373
• Gene ID - Rat: ENSRNOG00000017766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CA12 pAb (ATL-HPA008773) – 8 Found

Richardson, Stephen M; Ludwinski, Francesca E; Gnanalingham, Kanna K; Atkinson, Ross A; Freemont, Anthony J; Hoyland, Judith A. Notochordal and nucleus pulposus marker expression is maintained by sub-populations of adult human nucleus pulposus cells through aging and degeneration. Scientific Reports. 2017;7(1):1501. 

Ambrosetti, Damien; Dufies, Maeva; Dadone, Bérengère; Durand, Matthieu; Borchiellini, Delphine; Amiel, Jean; Pouyssegur, Jacques; Rioux-Leclercq, Nathalie; Pages, Gilles; Burel-Vandenbos, Fanny; Mazure, Nathalie M. The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. Plos One. 13(2):e0193477. 

Davidson, Ben; Stavnes, Helene Tuft; Holth, Arild; Chen, Xu; Yang, Yanqin; Shih, Ie-Ming; Wang, Tian-Li. Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions. Journal Of Cellular And Molecular Medicine. 2011;15(3):535-44. 

Tafreshi, Narges K; Bui, Marilyn M; Bishop, Kellsey; Lloyd, Mark C; Enkemann, Steven A; Lopez, Alexis S; Abrahams, Dominique; Carter, Bradford W; Vagner, Josef; Grobmyer, Stephen R; Gillies, Robert J; Morse, David L. Noninvasive detection of breast cancer lymph node metastasis using carbonic anhydrases IX and XII targeted imaging probes. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2012;18(1):207-19. 

Vermeulen, Jeroen F; van Brussel, Aram S A; van der Groep, Petra; Morsink, Folkert H M; Bult, Peter; van der Wall, Elsken; van Diest, Paul J. Immunophenotyping invasive breast cancer: paving the road for molecular imaging. Bmc Cancer. 2012;12( 22695343):240. 

Vermeulen, Jeroen F; Kornegoor, Robert; van der Wall, Elsken; van der Groep, Petra; van Diest, Paul J. Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer. Plos One. 8(1):e53353. 

Lloyd, Mark C; Cunningham, Jessica J; Bui, Marilyn M; Gillies, Robert J; Brown, Joel S; Gatenby, Robert A. Darwinian Dynamics of Intratumoral Heterogeneity: Not Solely Random Mutations but Also Variable Environmental Selection Forces. Cancer Research. 2016;76(11):3136-44. 

Lenting, Krissie; van den Heuvel, Corina N A M; van Ewijk, Anne; ElMelik, Duaa; de Boer, Remco; Tindall, Elizabeth; Wei, Ge; Kusters, Benno; Te Dorsthorst, Maarten; Ter Laan, Mark; Huynen, Martijn A; Leenders, William P. Mapping actionable pathways and mutations in brain tumours using targeted RNA next generation sequencing. Acta Neuropathologica Communications. 2019;7(1):185.