Anti CA12 pAb (ATL-HPA008773)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008773-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CA12
Alternative Gene Name: HsT18816
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032373: 88%, ENSRNOG00000017766: 88%
Entrez Gene ID: 771
Uniprot ID: O43570
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
| Gene Sequence | TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQ |
| Gene ID - Mouse | ENSMUSG00000032373 |
| Gene ID - Rat | ENSRNOG00000017766 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CA12 pAb (ATL-HPA008773) | |
| Datasheet | Anti CA12 pAb (ATL-HPA008773) Datasheet (External Link) |
| Vendor Page | Anti CA12 pAb (ATL-HPA008773) at Atlas Antibodies |
| Documents & Links for Anti CA12 pAb (ATL-HPA008773) | |
| Datasheet | Anti CA12 pAb (ATL-HPA008773) Datasheet (External Link) |
| Vendor Page | Anti CA12 pAb (ATL-HPA008773) |
| Citations for Anti CA12 pAb (ATL-HPA008773) – 8 Found |
| Richardson, Stephen M; Ludwinski, Francesca E; Gnanalingham, Kanna K; Atkinson, Ross A; Freemont, Anthony J; Hoyland, Judith A. Notochordal and nucleus pulposus marker expression is maintained by sub-populations of adult human nucleus pulposus cells through aging and degeneration. Scientific Reports. 2017;7(1):1501. PubMed |
| Ambrosetti, Damien; Dufies, Maeva; Dadone, Bérengère; Durand, Matthieu; Borchiellini, Delphine; Amiel, Jean; Pouyssegur, Jacques; Rioux-Leclercq, Nathalie; Pages, Gilles; Burel-Vandenbos, Fanny; Mazure, Nathalie M. The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. Plos One. 13(2):e0193477. PubMed |
| Davidson, Ben; Stavnes, Helene Tuft; Holth, Arild; Chen, Xu; Yang, Yanqin; Shih, Ie-Ming; Wang, Tian-Li. Gene expression signatures differentiate ovarian/peritoneal serous carcinoma from breast carcinoma in effusions. Journal Of Cellular And Molecular Medicine. 2011;15(3):535-44. PubMed |
| Tafreshi, Narges K; Bui, Marilyn M; Bishop, Kellsey; Lloyd, Mark C; Enkemann, Steven A; Lopez, Alexis S; Abrahams, Dominique; Carter, Bradford W; Vagner, Josef; Grobmyer, Stephen R; Gillies, Robert J; Morse, David L. Noninvasive detection of breast cancer lymph node metastasis using carbonic anhydrases IX and XII targeted imaging probes. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2012;18(1):207-19. PubMed |
| Vermeulen, Jeroen F; van Brussel, Aram S A; van der Groep, Petra; Morsink, Folkert H M; Bult, Peter; van der Wall, Elsken; van Diest, Paul J. Immunophenotyping invasive breast cancer: paving the road for molecular imaging. Bmc Cancer. 2012;12( 22695343):240. PubMed |
| Vermeulen, Jeroen F; Kornegoor, Robert; van der Wall, Elsken; van der Groep, Petra; van Diest, Paul J. Differential expression of growth factor receptors and membrane-bound tumor markers for imaging in male and female breast cancer. Plos One. 8(1):e53353. PubMed |
| Lloyd, Mark C; Cunningham, Jessica J; Bui, Marilyn M; Gillies, Robert J; Brown, Joel S; Gatenby, Robert A. Darwinian Dynamics of Intratumoral Heterogeneity: Not Solely Random Mutations but Also Variable Environmental Selection Forces. Cancer Research. 2016;76(11):3136-44. PubMed |
| Lenting, Krissie; van den Heuvel, Corina N A M; van Ewijk, Anne; ElMelik, Duaa; de Boer, Remco; Tindall, Elizabeth; Wei, Ge; Kusters, Benno; Te Dorsthorst, Maarten; Ter Laan, Mark; Huynen, Martijn A; Leenders, William P. Mapping actionable pathways and mutations in brain tumours using targeted RNA next generation sequencing. Acta Neuropathologica Communications. 2019;7(1):185. PubMed |