Anti CA10 pAb (ATL-HPA057837)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057837-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CA10
Alternative Gene Name: CA-RPX, CARPX, HUCEP-15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056158: 100%, ENSRNOG00000002626: 100%
Entrez Gene ID: 56934
Uniprot ID: Q9NS85
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
| Gene Sequence | PSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK |
| Gene ID - Mouse | ENSMUSG00000056158 |
| Gene ID - Rat | ENSRNOG00000002626 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CA10 pAb (ATL-HPA057837) | |
| Datasheet | Anti CA10 pAb (ATL-HPA057837) Datasheet (External Link) |
| Vendor Page | Anti CA10 pAb (ATL-HPA057837) at Atlas Antibodies |
| Documents & Links for Anti CA10 pAb (ATL-HPA057837) | |
| Datasheet | Anti CA10 pAb (ATL-HPA057837) Datasheet (External Link) |
| Vendor Page | Anti CA10 pAb (ATL-HPA057837) |
| Citations for Anti CA10 pAb (ATL-HPA057837) – 1 Found |
| Tao, Bangbao; Ling, Yiqun; Zhang, Youyou; Li, Shu; Zhou, Ping; Wang, Xiaoqiang; Li, Bin; Jun, Zhong; Zhang, Wenchuan; Xu, Chunyan; Shi, Juanhong; Wang, Lifeng; Zhang, Wenhao; Li, Shiting. CA10 and CA11 negatively regulate neuronal activity-dependent growth of gliomas. Molecular Oncology. 2019;13(5):1018-1032. PubMed |